Protein Info for ABID97_RS04745 in Variovorax sp. OAS795

Annotation: fused MFS/spermidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 390 to 408 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 87% identity to vap:Vapar_0459)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (675 amino acids)

>ABID97_RS04745 fused MFS/spermidine synthase (Variovorax sp. OAS795)
MERAGIQLLFAGTIFSSAFLLFLVQPLIAKQILPWFGGSAAVWSICMVFFQAVLLAGYAY
SDWVTRHLRVRVQAALHVGLLLASLALLPIVVRAAWKPGGAEDPTWLILGLLFATIGLPY
FLLSTTGPLVQSWVARTPWSTQVYRYFSLSNLASLLSLLCYPVLIEPRSSLWQQAWGWSW
GYGLFVLLCAGTTLLVARRWPGAAPLPTAAADTGKPPSWTDGLLWLVLPALASWLLLAVT
NHITQNVAAVPFLWILPLSLYLFTFVLCFESDRWYRRGIFLPLAAGVLVLCAFGLQHHIG
SDVRTGLPIYVGGLFVLCMFLHGETASLRPAPRFLTRFYLMMSLGGATGGALVGLVAPHV
LPAYYELGIGLTLSALAAAAVLYRRTWLRACSVALAACCAFFLVVQINGDRSDARQLLRN
FYGALITFDVRRTDPADNVRLLSHGSIKHGEQFLDPLRRREPTTYYGATSGIGRALAAAP
AEPRRVGLVGLGAGTLATYGRSGDTYRIYEINPQVFELADSEFTFLRDSPARIERVLGDA
RLALEREPPQGFDLLAVDAFSGDAVPVHLLTAEAMDVYLRHIRPDGIVAFHVTNRYLELA
PVVARIAELKGLHAMLVSDDAEASKWLNPTDWVLVARDAAVLSRGPLRGAASPVATGADA
RPWTDDFNNLLGALK