Protein Info for ABID97_RS04575 in Variovorax sp. OAS795

Annotation: NAD/NADP octopine/nopaline dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 12 to 25 (14 residues), see Phobius details transmembrane" amino acids 26 to 27 (2 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details PF03807: F420_oxidored" amino acids 10 to 107 (98 residues), 28.8 bits, see alignment E=3.2e-10 PF01210: NAD_Gly3P_dh_N" amino acids 11 to 108 (98 residues), 28.1 bits, see alignment E=3.6e-10 PF02558: ApbA" amino acids 11 to 108 (98 residues), 29.1 bits, see alignment E=1.4e-10 PF02317: Octopine_DH" amino acids 188 to 329 (142 residues), 115.9 bits, see alignment E=3.2e-37

Best Hits

KEGG orthology group: None (inferred from 85% identity to vap:Vapar_0420)

Predicted SEED Role

"D-octopine dehydrogenase (EC 1.5.1.11)" (EC 1.5.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>ABID97_RS04575 NAD/NADP octopine/nopaline dehydrogenase family protein (Variovorax sp. OAS795)
MTEPAGQRHRVGIAGAGAIAFASAAWLRQAGHTVTLWSPGGQGAEALRKRPLEAGGVLAC
RVSVEVADDAAQLCQAADVLLLALPVNGHRRVMDALLPFLRDGQMVIVSSMASLSSLYLY
ENARQVGLRITVASFGTTVLTARRESATLVRVMTRRQAVGVSALPGGDVGKVLDLCTALF
GGSFFAQDNTLASALANVNPQSHGPLAVFNWTRIERAENWPQYHCMTPGVARAIEALDLE
RRAVARAFGLELGPIEAHFARSFGTASARLEDIAAELHAKRGGPPGPVRTDTRYVSEDMP
YGLAFVEALGRIAGVPTPATRTIVDAASLVNGIDYRQQNDLLAPLGLAKETVAGLLARL