Protein Info for ABID97_RS04540 in Variovorax sp. OAS795

Annotation: glucose-1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 22 to 404 (383 residues), 504.1 bits, see alignment E=1.1e-155 PF00483: NTP_transferase" amino acids 24 to 298 (275 residues), 218.8 bits, see alignment E=1.7e-68 PF12804: NTP_transf_3" amino acids 24 to 149 (126 residues), 27.9 bits, see alignment E=4.9e-10 PF24894: Hexapep_GlmU" amino acids 321 to 424 (104 residues), 139.5 bits, see alignment E=7.8e-45

Best Hits

Swiss-Prot: 69% identical to GLGC_PARXL: Glucose-1-phosphate adenylyltransferase (glgC) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 95% identity to vap:Vapar_0413)

MetaCyc: 66% identical to glucose-1-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate adenylyltransferase. [EC: 2.7.7.27]

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>ABID97_RS04540 glucose-1-phosphate adenylyltransferase (Variovorax sp. OAS795)
MDNDSSTTPQASLQAHQLVRRTIALVLAGGRGSRLKQLTDRRAKPAVYFGGKFRIIDFAL
SNCLNSGIRRMAVVTQYKSHSLMRHLQRGWSFLRAELNEMVDVLPAQQRTGDEHWYRGTA
DAVFQNLDIIQTRSTKHDYVVVLAGDHIYKMDYSIMVKDHAERGLGCTVGCIEVPRMEAT
AFGVMAIDDDRQITAFLEKPADPPAMPGHPDVALASMGIYVFDSEYLYQLLEEDAINPDS
SHDFGKDIIPRAVAQGRALAHPFGMSCVTRASRGPGAKAYWRDVGTIDAFWAANLDLASI
TPELDIYDTDWPIWTYQRQLPPAKFVLDRDGKHGMTVNTIVSGGCIVSGSKVSSSVLFSG
VRIHSFCEINEAVLLPDVEVGRACKLNRVVIDRGCVIPDEMVIGEDAEADAARFERTEAG
VVLVTREMLKRLAA