Protein Info for ABID97_RS04465 in Variovorax sp. OAS795

Annotation: dipeptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF00005: ABC_tran" amino acids 37 to 186 (150 residues), 113.2 bits, see alignment E=1.5e-36 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 236 to 318 (83 residues), 84.3 bits, see alignment E=2.4e-28 PF08352: oligo_HPY" amino acids 238 to 299 (62 residues), 65.2 bits, see alignment E=5.7e-22

Best Hits

Swiss-Prot: 58% identical to DPPF_ECOLI: Dipeptide transport ATP-binding protein DppF (dppF) from Escherichia coli (strain K12)

KEGG orthology group: K12372, dipeptide transport system ATP-binding protein (inferred from 91% identity to vap:Vapar_0398)

MetaCyc: 58% identical to dipeptide ABC transporter ATP binding subunit DppF (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>ABID97_RS04465 dipeptide ABC transporter ATP-binding protein (Variovorax sp. OAS795)
MSEMPGDAVVDARNLQRTYAVRRGMFRAATQLRAVGDISFRIDRGRTLAVVGESGCGKST
LARMVALIEKPTAGQLTLVGHDAVSTPPEHRRELRQAVQLVFQNPYGSLNPRKKISTVLE
DPLAINTTLGKTQRADKAREMLARVGLRPEHANRYPHMFSGGQRQRIAIARALMLEPRLL
VADEPVSALDVSIQAQVLNLLADLQAELGLAYLFISHDLGVVRHIAHDVLVMYLGHAVEQ
GPKSRIFARPLHPYTQALLASTPGLSSQRIVLKGELPSPLDPPSGCVFSTRCSHVTARCR
EERPLLRALDERLVACHYAEKFLDGAAPVGADMPLSPPFVAPLATSP