Protein Info for ABID97_RS04410 in Variovorax sp. OAS795

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF00296: Bac_luciferase" amino acids 3 to 300 (298 residues), 158.4 bits, see alignment E=1.4e-50 TIGR03558: luciferase family oxidoreductase, group 1" amino acids 4 to 322 (319 residues), 459.4 bits, see alignment E=3.4e-142

Best Hits

Swiss-Prot: 60% identical to YHBW_ECOL6: Luciferase-like monooxygenase (yhbW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00494, alkanal monooxygenase (FMN-linked) [EC: 1.14.14.3] (inferred from 97% identity to vap:Vapar_0386)

Predicted SEED Role

"Bacterial luciferase family protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>ABID97_RS04410 LLM class flavin-dependent oxidoreductase (Variovorax sp. OAS795)
MIPFSILDLSPITEGSDAAQSFRNSLSLAQHGEALGYRRYWLAEHHGMPGIASAATAVLL
AHIGAGTSTIRIGAGGVMLPNHSPLVIAEQFGTLESLYPGRIDLGLGRAPGSDQRTARAL
RRNLESDADQFPQDVVELMDFMSKAPQQPVRAVPGAGLEVPVWILGSSTFGAQLAAHLGL
PYAFASHFAPQQLLQAIRIYRETFKPSAQLQKPYVMLGFNVFVADTDDEAEFRATSWQQA
FVNLRSGRPGRLPPPVENYRQKVGPAENALLDSVLSCSAVGSPAKVREGVQAFIDRTGAD
ELMITSQVFDHAARLRSYELLAGLRGQG