Protein Info for ABID97_RS03930 in Variovorax sp. OAS795

Annotation: Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 TIGR00135: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit" amino acids 4 to 99 (96 residues), 80.8 bits, see alignment E=3.6e-27 PF02686: GatC" amino acids 20 to 94 (75 residues), 63.9 bits, see alignment E=6.1e-22

Best Hits

Swiss-Prot: 94% identical to GATC_VARPS: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (gatC) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02435, aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C [EC: 6.3.5.6 6.3.5.7] (inferred from 92% identity to vpe:Varpa_0292)

Predicted SEED Role

"Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)" (EC 6.3.5.6, EC 6.3.5.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.6, 6.3.5.7

Use Curated BLAST to search for 6.3.5.6 or 6.3.5.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (99 amino acids)

>ABID97_RS03930 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC (Variovorax sp. OAS795)
MSLSASDIARIASLARLQLAPDESERMLSQINGFFDLVERMRSVDTAGVEPLAHPVAAVQ
DVTLRLRDDVVSEANNREANQKSAPAVEAGLFLVPKVIE