Protein Info for ABID97_RS03850 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 270 (171 residues), 78.5 bits, see alignment E=2.9e-26

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 96% identity to vap:Vapar_0267)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>ABID97_RS03850 ABC transporter permease (Variovorax sp. OAS795)
MADASTTTAAPWTPPAAGATAAVPRPPLRDRLLPLIGPVVLFIVWDLAVRLGFIKPILLP
TPADTVAALITGLAGGPLLTDFAMTVWRTLQAFAIAAVVGVPLGVLLGSNEKAYRSVEFL
IDFFRSTPSSALIPLFLLIFGVSDVNKVAIAAFGALLIVVFNSAYGVINARKQRVMAARV
MGASRWQIFKDVLVWESLQPSFVGLRSAVSMALVIVIVAEMFIGSDTGLGHRIIDAQQVL
NVKSMYAAILAAGALGYALNILFLVAERRIVHWSGR