Protein Info for ABID97_RS03155 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 256 (171 residues), 78.8 bits, see alignment E=2.3e-26

Best Hits

KEGG orthology group: None (inferred from 93% identity to vpe:Varpa_0117)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>ABID97_RS03155 ABC transporter permease (Variovorax sp. OAS795)
MNAQGRVGALNWLGSLAVLCALVALWWVASNAGWVSRVFLPTPQATFASLLDGLNLSGGS
GNGELLAFTQATVGRMVQGWLLASLFGVLLGAAIGVSPAVRAWVQPTLEFIRPLPASALL
PLAISIFGLNPGMVLFVVAFGAMWPVLLATVHGFAAVEPRLSEVARCLQMSRAAFVWKMG
LPNAMPDILAGMRLALTIALIVAVVGEMIASQSGLGQAILLAARAFRASDLFAGIVLLGL
IGFASNALLALAERRLLRWQQP