Protein Info for ABID97_RS03095 in Variovorax sp. OAS795

Annotation: benzoate-CoA ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 transmembrane" amino acids 72 to 92 (21 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 262 to 275 (14 residues), see Phobius details TIGR02262: benzoate-CoA ligase family" amino acids 7 to 511 (505 residues), 804.1 bits, see alignment E=2.6e-246 PF00501: AMP-binding" amino acids 19 to 378 (360 residues), 289 bits, see alignment E=5.1e-90 PF13193: AMP-binding_C" amino acids 428 to 503 (76 residues), 79.8 bits, see alignment E=2.4e-26

Best Hits

KEGG orthology group: K04110, benzoate-CoA ligase [EC: 6.2.1.25] (inferred from 94% identity to vap:Vapar_0089)

Predicted SEED Role

"Benzoate-CoA ligase (EC 6.2.1.25)" in subsystem Benzoate transport and degradation cluster (EC 6.2.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>ABID97_RS03095 benzoate-CoA ligase family protein (Variovorax sp. OAS795)
MTSPPARFNFAEHLFALNRGRADRIAYIDDRGTLAYGQLEDRARRLATALKAAGLRREER
VLLLMLDSADWPVSFLGCLYAGVVPVAVNTLLTPDDYAYMLDHSRAQAVLVSGALLPTLQ
EAMGRGAHEVHTLVVSQPTGALPAGAQEFEAAIAAAEPMASAVATASDDPGFWLYSSGST
GKPKGTVHTHANLWWTAELYGKPVLGLTEDDVCFSAAKMYFAYGLGNALTFPLSVGATVV
LMAERPTPDATFRRWVAHKPTVFFGAPTGFAGMLASPKLPAREQVALRMCSSAGEALPGE
IAQRFKAHFGCEIIDGIGSTEMLHIFISNRPGDVRYGTTGKPVEGYEVELRGEDGRPVPD
GEVGDLYIRGPSAALMYWCNREKTRETFQGGWTKSGDKYTRDADGYYTYAGRSDDMLKVS
GIYVSPFEVEATLMQHPAVLEAAVIGKEDSDGLTKTKAFVVLKDGQSVSDDELKAFVKER
LAPYKYPRFLEFVQELPKTATGKIQRFRLREREKQA