Protein Info for ABID97_RS03075 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 40 to 309 (270 residues), 152.3 bits, see alignment E=7.4e-49

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 97% identity to vap:Vapar_0085)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator precursor" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>ABID97_RS03075 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MTEATTSMRSTASTRLGALAVPVACAIAIAVLGPLMGNYVSDFVVKVMILSIFALSLELL
VGMTGLVSLGHAAFYGIGAYVTVLASGSEGGNLALLLPAAMGAAALYALFVGALSLRTRG
VYFIMVTLAFAQMAFFVFHDTKVGGGSDGIYMYVRPAIGKLDLENRMVLFYVVLASLVFT
YGLLALVRRSRFGAALAGIRVNEQRMRAAGFPVYGYKLAAFVLAGALAGLAGFLLASRDG
VVNPELMAWHNSGEVLLMVILGGLGHLRGAVIGAIAFTLLKEIFSTHAVMGPLADHWQLT
LGIAIIVFVALLPKGLIGLAKRLSPKEAA