Protein Info for ABID97_RS02885 in Variovorax sp. OAS795

Annotation: glutathione transferase GstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF02798: GST_N" amino acids 1 to 74 (74 residues), 30.9 bits, see alignment E=8.7e-11 PF13409: GST_N_2" amino acids 10 to 75 (66 residues), 33 bits, see alignment E=2.3e-11 PF13417: GST_N_3" amino acids 15 to 79 (65 residues), 24.8 bits, see alignment E=6.7e-09 PF00043: GST_C" amino acids 103 to 189 (87 residues), 49.3 bits, see alignment E=1.4e-16 PF14497: GST_C_3" amino acids 109 to 193 (85 residues), 36.4 bits, see alignment E=1.6e-12 PF13410: GST_C_2" amino acids 123 to 184 (62 residues), 41.5 bits, see alignment E=3.5e-14

Best Hits

Swiss-Prot: 47% identical to GST_PROMI: Glutathione S-transferase GST-6.0 (gstB) from Proteus mirabilis

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 95% identity to vap:Vapar_0042)

MetaCyc: 44% identical to glutathione S-transferase GstA (Escherichia coli K-12 substr. MG1655)
Glutathione transferase. [EC: 2.5.1.18]

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>ABID97_RS02885 glutathione transferase GstA (Variovorax sp. OAS795)
MKLYYSPGACSLSPHIALHEAGIAFEPVMASTKSHKLQDGTDYYGINPLGYVPMLELDDG
TRLREGPAIVQYIADLAPTKNLAPAAGTLQRYRLQEWLTFIGTEMHKGYSPLFNPAMPEE
AKTLFKDKLKSRYQWLDGQLADKQYLMGEHFSVADGYLFTVTNWAKPTGVDISGFPNLQA
WHARVGARPAVQSAMKAEGLLK