Protein Info for ABID97_RS02685 in Variovorax sp. OAS795

Annotation: DNA polymerase III subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR00663: DNA polymerase III, beta subunit" amino acids 7 to 367 (361 residues), 317.3 bits, see alignment E=6.2e-99 PF00712: DNA_pol3_beta" amino acids 8 to 120 (113 residues), 91.3 bits, see alignment E=7.5e-30 PF02767: DNA_pol3_beta_2" amino acids 132 to 245 (114 residues), 113.1 bits, see alignment E=1.4e-36 PF02768: DNA_pol3_beta_3" amino acids 248 to 367 (120 residues), 116.3 bits, see alignment E=1.1e-37

Best Hits

Swiss-Prot: 46% identical to DPO3B_PSEAE: Beta sliding clamp (dnaN) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02338, DNA polymerase III subunit beta [EC: 2.7.7.7] (inferred from 100% identity to vap:Vapar_0002)

Predicted SEED Role

"DNA polymerase III beta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>ABID97_RS02685 DNA polymerase III subunit beta (Variovorax sp. OAS795)
MIVLKATQDKVLAALQSVAGIVERRHTLPILANVLIRKTGGQLQLTTSDLEIQIRTTAEL
GGDEGSFTTTIGARKLIDILRTMPADQTVSLESSASKLVLKGGKSRFTLQSLPAEDFPLV
QEAANFGPVFSVPQKTLKDLLSQVSFAMAVHDIRYYLNGILFVAEGKQLSLVATDGHRLA
FSSATLDVEVPRQEVILPRKTVLEMQRLLSDAEGAIEMQFANNQAKFSFGGMEFVTKLVE
GKFPDYNRVIPKNHKNSVTLGRAPLLASLQRTAILTSEKFKGVRLNIEPGLLRIASNNAE
QEEAQDELDIDYGGDAIEIGFNVTYLIDALSNMDQDMVKLDLADSNSSALLTIPENASFK
YVVMPMRI