Protein Info for ABID97_RS02655 in Variovorax sp. OAS795

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF10396: TrmE_N" amino acids 10 to 136 (127 residues), 118.8 bits, see alignment E=3.1e-38 TIGR00450: tRNA modification GTPase TrmE" amino acids 14 to 469 (456 residues), 288.8 bits, see alignment E=8.5e-90 PF12631: MnmE_helical" amino acids 139 to 466 (328 residues), 198.6 bits, see alignment E=3e-62 TIGR00231: small GTP-binding protein domain" amino acids 232 to 329 (98 residues), 65.8 bits, see alignment E=3.9e-22 PF01926: MMR_HSR1" amino acids 234 to 355 (122 residues), 79.2 bits, see alignment E=5.2e-26 PF02421: FeoB_N" amino acids 234 to 319 (86 residues), 31.2 bits, see alignment E=3e-11

Best Hits

Swiss-Prot: 73% identical to MNME_ACIAC: tRNA modification GTPase MnmE (mnmE) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 93% identity to vpe:Varpa_6019)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>ABID97_RS02655 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE (Variovorax sp. OAS795)
MTFARTTDPIAAIATASGRGAVGIVRVSGARLAPLIDALCGRPLKPREATYLPFRDAAGE
PVDHGLAIHFPSPHSFTGEDVLELQAHGGAVVLQLLLARCLEAAAEPDPATGKPRLPGLR
VAEPGEFSQRAFLNGKIDLAQAEAIADLIDASTEAAARSAGRSLSGAFSREIHTLRDALI
HLRMLVEATLDFPEEEIDFLQKADAAGQLARLQAQLAAVQQRAKQGALLREGIKVVIAGQ
PNAGKSSLLNALAGAELAIVSAVAGTTRDVVSQTIQIHGVPLHVADTAGLRESSDEVEQI
GVARAWGQIESADAVLFLHDLTRASLPDYAAADAGILRSLRQKLPASVPVLDVWNKQDAA
PMAGIAEGIALSARTGLGIEALREQLLAMAGWQAVPEGVYLARARHVQALARVDTHLRLA
GSHLAAQAQMLDLLAEELRLAQNALNEITGEFGADDLLGVIFSRFCIGK