Protein Info for ABID97_RS02585 in Variovorax sp. OAS795

Annotation: ion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 111 to 137 (27 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details PF00520: Ion_trans" amino acids 48 to 258 (211 residues), 103.7 bits, see alignment E=9.6e-34 PF07885: Ion_trans_2" amino acids 181 to 255 (75 residues), 51.4 bits, see alignment E=8.2e-18

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_5285)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>ABID97_RS02585 ion transporter (Variovorax sp. OAS795)
MTRSNTAPAARTLAISSTIDARFDKPASGWRRSLFTVIFEADTRAGLMFDLALIAVIVTS
VLVVILDSVQSIREQWRPLFNVLEWVFTILFTLEYIARLACVNKPLRYALSFYGVIDLLA
LLPTFLVAFAPELAYLIDVRILRLLRVFRIFKLSRYSVEYRALVSAVAASRRKITVFVGF
VMLVVLVMGTLMYVVEGPVHGFTSIPVAIYWAISTMATVGFGDLVPKTDLGRAIASVMML
LGWGVLAVPTGIVTAEMARRGPDDDVALAIAPRGVLAMTPTPAAVPARRLTPAARRRALA
QHRRGGR