Protein Info for ABID97_RS02235 in Variovorax sp. OAS795

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 126 to 153 (28 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 13 to 186 (174 residues), 227 bits, see alignment E=6.4e-72 PF03741: TerC" amino acids 14 to 184 (171 residues), 163.6 bits, see alignment E=2e-52

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_5913)

Predicted SEED Role

"Membrane protein TerC, possibly involved in tellurium resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>ABID97_RS02235 TerC family protein (Variovorax sp. OAS795)
MELVQSADFWIGLFKIIWINIILSGDNAVVIAMAARSLPPAQQQKAVLFGSGAAVVLRIV
LTVVAAKLLALPYLQIVGGLLLLWIGVQLLGEEDEGEGESKEYGSMLAAVRTILLADLVM
SLDNVIAVAAAAHGSMVLLILGLAISIPLVIFGSTLMIKLMERFPIIVMLGAALIGWVGG
ETIASDVALKGMLGANPWLHYAAAAAGALFVVAAGRFLQRRARAAARH