Protein Info for ABID97_RS02205 in Variovorax sp. OAS795

Annotation: Wzy polymerase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 5 to 21 (17 residues), see Phobius details amino acids 29 to 48 (20 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 211 to 227 (17 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 359 to 376 (18 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details PF15864: PglL_A" amino acids 157 to 180 (24 residues), 26.6 bits, see alignment (E = 6.6e-10) PF04932: Wzy_C" amino acids 196 to 340 (145 residues), 52.6 bits, see alignment E=7.1e-18 PF11846: Wzy_C_2" amino acids 363 to 534 (172 residues), 67.9 bits, see alignment E=1.9e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>ABID97_RS02205 Wzy polymerase domain-containing protein (Variovorax sp. OAS795)
MTRRLMIFMGMVLGLAYLVPNHIPPWVVFHEDAVAAAAFIPLLIWGLFPRQPKPTLMLLA
LIMAAVPVGQLLSGQILFASDSWLASLYLLGFAFSVLAGARIVSAEPAQHLALKDLAPLF
ACFIFAGLLSVAFAIHQWLDLGISGLYVVDLRFGERPYANLAQPNQLATLLLLAQVGLIF
MFEMRAIRAPVALAGATILAFGLAMTQSRSVFIALFFFWAAFLVLRTRASLRTTLLPLLS
ITVLYACVAWAWPTINDLLLLSGGSSLAERLHQDLRLTVWMQMLDAVLRSPWLGYGWNQV
PIAQYATALEHSATNHFFTSAHNLFFDLAIWCGLPLATIVILCLLVWFVQQIKHCRDPLS
WCALVAIILVFGHSLVEFPLYYAYFLLPIGLLMGALQVNLPKTKTWNIRLPQFPLWSGAI
AAIALFAAILVEYPPWEQEWQRLRFEKARIGARENIPAPRVFLLTEFPEIAKFARAEAKP
NMSKADLDEMFRVVQRFGWANNLFKYAVATGLNGDPKKAEETLARLCKMHTEKNCMEARE
TWRELSREKYPELGNIKFPTLRD