Protein Info for ABID97_RS02030 in Variovorax sp. OAS795

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR02957: RNA polymerase sigma-70 factor, TIGR02957 family" amino acids 7 to 286 (280 residues), 354.6 bits, see alignment E=3.4e-110 PF04542: Sigma70_r2" amino acids 8 to 71 (64 residues), 56.8 bits, see alignment E=1.6e-19 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 8 to 161 (154 residues), 68.8 bits, see alignment E=4.4e-23 PF08281: Sigma70_r4_2" amino acids 107 to 158 (52 residues), 48.7 bits, see alignment 4.8e-17

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 90% identity to vap:Vapar_5163)

Predicted SEED Role

"Putative RNA polymerase sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABID97_RS02030 RNA polymerase sigma-70 factor (Variovorax sp. OAS795)
MDDATLAFDSHRRRLQGIAYRMLGSVAEAEEVVQDAWLRWHEADKASLGSAEAWLVTVVT
RLSIDRLRAAKVQREHYIGAWMPEPTLTEPPDTPEESLERADNISVAFLAVLERLAPEAR
AAFLMREVFDADYDEVALTLGKSEAACRQLVHRAKAQLQEARPRYPVPRETHQRLLRAFA
DAAARGSLQDLKALMAEEAELIGDGGGKVQTFSKVLRGSQRLAQLYFSLWRRMGAAVRME
LAEINGEPGLLRFVDGELESAQTFEIEGERIVRIRVQRNPDKLARIARHFSSR