Protein Info for ABID97_RS01990 in Variovorax sp. OAS795

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF00072: Response_reg" amino acids 9 to 125 (117 residues), 80 bits, see alignment E=2.3e-26 PF08281: Sigma70_r4_2" amino acids 143 to 190 (48 residues), 32.9 bits, see alignment 5.9e-12 PF00196: GerE" amino acids 150 to 202 (53 residues), 72.3 bits, see alignment E=2.9e-24

Best Hits

Swiss-Prot: 48% identical to DCTR_RHOCA: C4-dicarboxylate transport transcriptional regulatory protein DctR (dctR) from Rhodobacter capsulatus

KEGG orthology group: K11712, two-component system, LuxR family, response regulator DctR (inferred from 95% identity to vap:Vapar_5156)

Predicted SEED Role

"Two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>ABID97_RS01990 response regulator (Variovorax sp. OAS795)
MQPLIDGLIFIVDDDASVREALAWLLRSRRLESEHFASAEAFEQRLADGPLPEQPLCLLL
DVRMPGTSGLVLFDRLAERGLLAAMPVIFLTGHADVPTAVDAVKRGAFDFCEKPFSDNAL
VDRIEQALGASLRALDLQRARRRLAGRVAELTERERDVMRLVVEGLPNKLIADQLAISVR
TVEVHRARVFDKMEVKSAVELANRLREL