Protein Info for ABID97_RS01345 in Variovorax sp. OAS795

Annotation: coniferyl-alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00106: adh_short" amino acids 10 to 124 (115 residues), 42.8 bits, see alignment E=6.3e-15 PF01370: Epimerase" amino acids 11 to 125 (115 residues), 40.5 bits, see alignment E=3.3e-14 PF13561: adh_short_C2" amino acids 14 to 129 (116 residues), 35.9 bits, see alignment E=9.7e-13 amino acids 160 to 254 (95 residues), 46.1 bits, see alignment E=7.2e-16

Best Hits

KEGG orthology group: K00037, 3-alpha-hydroxysteroid dehydrogenase [EC: 1.1.1.50] (inferred from 42% identity to bgl:bglu_2g06580)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>ABID97_RS01345 coniferyl-alcohol dehydrogenase (Variovorax sp. OAS795)
MDLDLSGKKFFVTGVASGIGHATAELLLRAGAEVVGADRAELSKPLALAAFHHLDLSDPA
LIDRAVAAAGDGYDALINVAGVSSLASTDMQFRVNFLGTRHLTLAMVPRLKARSAVFNVA
SSTAVRWEQHLDRFTPLVETRSFEEGLQWLEANPQESPISYAWSKEALIIWTMKTGLEWI
GTGRRINALSPGLTYTPMHAEFVQAHGEALLKKDAERTGDAGSAEDVAKALVLLQHDYAG
WWNAANINVDGGFSASVLLAKENFGDV