Protein Info for ABID97_RS00695 in Variovorax sp. OAS795

Annotation: D-alanyl-D-alanine carboxypeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00768: Peptidase_S11" amino acids 27 to 263 (237 residues), 247.6 bits, see alignment E=1.9e-77 PF13354: Beta-lactamase2" amino acids 43 to 187 (145 residues), 53.1 bits, see alignment E=4.2e-18 PF07943: PBP5_C" amino acids 283 to 373 (91 residues), 68.4 bits, see alignment E=7.4e-23

Best Hits

KEGG orthology group: K07258, D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5/6) [EC: 3.4.16.4] (inferred from 97% identity to vap:Vapar_4921)

Predicted SEED Role

"D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.16.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>ABID97_RS00695 D-alanyl-D-alanine carboxypeptidase family protein (Variovorax sp. OAS795)
MNRFLDAFRALVLTAAASVCMIAAAQVPAPPEVAARSYLLLDVTANQILAQKDIDSPVEP
ASLTKLMSAYIVFDALRAKKITLTQTMPVSQRAWKMPGSRMFIDPKMQVPVEDLIKGLIV
QSGNDATVALAEGVGGTVEHFVELMNAQAKALGMKNTSYKNPEGLTASGHTTTARDLSIL
ATRLVRDFPEEAKYYAIKKYRYPGTPSTNDTNRNLLLFRDPTVDGLKTGHTDAAGYCMIA
TAKRDFPNLTGGRRLLSIVLGASGETVRANESQKLLNWGYTAYDAVRLFDAGQPAATPAV
WKGKVNTLKLGRPDAIVVAVPAGTANKIKTQVARPDPLVAPFTKYQSVGSLKVTLDDQPL
ADVPLVALEGVEQAGIFGRAWDAVRLWIK