Protein Info for ABID97_RS00485 in Variovorax sp. OAS795

Annotation: ATP synthase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details PF03899: ATP-synt_I" amino acids 41 to 139 (99 residues), 49.1 bits, see alignment E=3.4e-17

Best Hits

KEGG orthology group: K02116, ATP synthase protein I (inferred from 94% identity to vap:Vapar_4877)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>ABID97_RS00485 ATP synthase subunit I (Variovorax sp. OAS795)
MKTIARKDERVAEDLDTEFKPLTADEASELRARHPSISPWRVIAGQLVVGLLVALAAWGL
TGRQNLGWSAAYGAIAVVIPAAVFARGLTGRFSSLNPGTAVVGFFLWEMVKMALSLAMLF
AAPMLITALSWPAMLVGLVVTMKAAWLAVMFSPRRRQHRDE