Protein Info for ABI39_RS20585 in Phocaeicola dorei CL03T12C01

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 206 to 222 (17 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 59 to 276 (218 residues), 58.8 bits, see alignment E=1.5e-19 PF00535: Glycos_transf_2" amino acids 63 to 224 (162 residues), 66.5 bits, see alignment E=5.7e-22 PF13632: Glyco_trans_2_3" amino acids 141 to 342 (202 residues), 30.5 bits, see alignment E=6.8e-11

Best Hits

KEGG orthology group: None (inferred from 97% identity to bvu:BVU_3982)

Predicted SEED Role

"Glycosyl transferase, group 2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>ABI39_RS20585 glycosyltransferase family 2 protein (Phocaeicola dorei CL03T12C01)
MNTLEILFFVLLFIVFYTYVGYGILLWILVKIKQSFLFFYDTDEPEQETCRNGNNTALPE
ITLFITAYNEEQVVDGKMKNCHELDYPKEKLHIVWVTDGSNDRTNEKLKAYPDVTLLFVP
ERKGKTAAMNRGMGFVTTPLVIFTDANTFINPQAVREIVKCFNHPQVGCVAGEKRVDMYS
TGGAVSGGEGLYWKYESWLKKMDYQLYSAIGAAGELFAIRTPLYEEMPEDTLLDDFMLSL
HIAMKQYTIAYCDTAYALESGSADMKEEEKRKIRISAGGLQSVYRLKELLNPLRYGILSF
QYVSHRVLRWSVTPVALFLLFPLNILLVVCSESHPVYFLFLLLQSAFYLGGVYGSFLSAK
SVKNKLLYIPYYFLFMNINVIKGFFYLKRHAGGTWEKSRRA