Protein Info for ABI39_RS20165 in Phocaeicola dorei CL03T12C01

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 757 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 366 to 389 (24 residues), see Phobius details PF08447: PAS_3" amino acids 431 to 506 (76 residues), 28.2 bits, see alignment E=2.8e-10 PF00512: HisKA" amino acids 538 to 604 (67 residues), 69.7 bits, see alignment E=2.7e-23 PF02518: HATPase_c" amino acids 650 to 755 (106 residues), 87.9 bits, see alignment E=9.3e-29

Best Hits

Predicted SEED Role

"Two-component system sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (757 amino acids)

>ABI39_RS20165 PAS domain-containing sensor histidine kinase (Phocaeicola dorei CL03T12C01)
MKHKAFFIFMTALLIGSPLYAQKYKIALIHSYQEGYSGAGIVNKLFVKGLKDQQIDFQLR
TFYLDCEKYESVEEEQRISEFADSIRSWEGDLIAVLDDQATYSIMACGNPYVRQIPVVFS
GVNYPNQDLLAQYPNITGYIDKPDYLTTCRMIERIMGKVRIHILNGRTVLDRLIWKDLSE
QCKGSEITLHQWKRQEALPGKLNIPISDKDDTEYESLHEKLNEYNHLDSTIVVRLSSDSV
AARDLMWLSSGIFKYSLFLYTKRDYTTLRIGSLFDNPGFETINEGFGIKEYMLGGYFAPI
ETQLSDMTAGIKERLQGKIPVPAVKQIAKQHLVNWQAMKRYQIPTESIPPEYTIMYRPWR
EKYATPILILESLLVFTLLLGISYLIYIYTLEKGRKKEALRNLRLKHEALTLALEGGKTY
AWCFDGKTAVFDQAFCELTNRSQNLLEIKEIANYVHPGDQAQFRKNVSNILHRPRRTAQY
RCKFDDTGYQWWEFRYSVLQHYEQNPIITGLLVNIQEIKDKEEELIRARKLAEQAELKQS
FLANMSHEIRTPLNAIVGFSNLLTTEKNISEEEKKEFASIIDNNTRLLLKLVNDVLELSR
IESGNMSFHCEDCSAHHFAETVYQTHQVIILPPVEFIKEFPDEDVTIHIDRMRLTQVITN
FLGNAKKFTSQGHIKLGYFCDKEKKEIHFFVEDTGAGIPKEELQMIFERFYKRNEFVQGV
GLGLAISKVIVEKMNGHIDVQSEVNKGSRFTAVLPYL