Protein Info for ABI39_RS20120 in Phocaeicola dorei CL03T12C01

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 31 to 56 (26 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details PF00892: EamA" amino acids 26 to 138 (113 residues), 53.5 bits, see alignment E=1.4e-18 amino acids 153 to 290 (138 residues), 51.6 bits, see alignment E=5.7e-18

Best Hits

KEGG orthology group: None (inferred from 96% identity to bvu:BVU_3893)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>ABI39_RS20120 DMT family transporter (Phocaeicola dorei CL03T12C01)
MNKQVEANLSMVVSKALGGLNMNALKYLLPLWIAPVTGVTFRLVFGAAAFWLIDIFCKPE
NSTIRQKWQLFMLGALGIYGYMFFYLLGISKTTPVSSSIFVSLEPIWVFIIAVLFYKEKV
TWMKVFGIGMGLGGAILCISTQPSDDLASNAPLGNLMCLVSSLVYAVYLVLSNRLLKGVG
NMTMLKYTFLGAAVMAVIVNTIYGFDAPILRMSLFSTPMLVLLFVLVFPTTISYLLLPLG
LKYLKTTLVAIYGYLILIVATVASFILGQDRFSWTQLAAIVLICASVYLVEVAESKSEKQ
IISKSR