Protein Info for ABI39_RS18850 in Phocaeicola dorei CL03T12C01

Annotation: twin-arginine translocase TatA/TatE family subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01411: twin arginine-targeting protein translocase, TatA/E family
  • amino acids 9 to 54 (46 residues), 56.7 bits, E=6.8e-20
• PF02416: TatA_B_E
  • amino acids 10 to 60 (51 residues), 52.5 bits, E=1.1e-18

Best Hits

Swiss-Prot: 54% identical to TATA_CHLL7: Sec-independent protein translocase protein TatA (tatA) from Chlorobium luteolum (strain DSM 273 / 2530)

KEGG orthology group: K03116, sec-independent protein translocase protein TatA (inferred from 67% identity to bsa:Bacsa_2581)

Predicted SEED Role

"Twin-arginine translocation protein TatA" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Protein Sequence (67 amino acids)

>ABI39_RS18850 twin-arginine translocase TatA/TatE family subunit (Phocaeicola dorei CL03T12C01)
MTGTLLFLGLGMQEVLFIALIVLLFFGGKKIPELMKGLGKGVKSFKEGMNGLEDDIDGKD
KKGETKK