Protein Info for ABI39_RS18845 in Phocaeicola dorei CL03T12C01

Annotation: twin-arginine translocase subunit TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 11 to 250 (240 residues), 170.8 bits, see alignment E=2e-54 PF00902: TatC" amino acids 12 to 245 (234 residues), 226.6 bits, see alignment E=1.5e-71

Best Hits

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 97% identity to bvu:BVU_3808)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>ABI39_RS18845 twin-arginine translocase subunit TatC (Phocaeicola dorei CL03T12C01)
MEQQQKILTFWDHLEELRHVLFRIAVAVVFLMLVAFLFKDELFAIVLAPKNADFIIYHFF
CRIADSMAMPSLCPEVFYVKMINTQLAAQFITHMSVSFYAGFLLASPYVIYQLFRFVSPA
LYENEKKYSTRVVGWGYFLFMMGVLLNYFLIFPLTFRFLATYQVSMEVENTITLSSYMDT
LMMMSLMMGIVFEIPVLCWLFAKLGFLTADFMKRYRRHAIVIILIVGAVITPTSDVFTLM
MVSVPMYLLYEVSIWIVSRTGKKQQEESLEEVFEKS