Protein Info for ABI39_RS18775 in Phocaeicola dorei CL03T12C01

Annotation: WG repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF14903: WG_beta_rep" amino acids 42 to 76 (35 residues), 41.7 bits, see alignment (E = 9.7e-15) amino acids 76 to 108 (33 residues), 25.2 bits, see alignment (E = 1.4e-09) amino acids 134 to 167 (34 residues), 26.9 bits, see alignment (E = 4e-10) amino acids 168 to 203 (36 residues), 37.1 bits, see alignment 2.6e-13 amino acids 215 to 236 (22 residues), 23.6 bits, see alignment (E = 4.4e-09) amino acids 409 to 444 (36 residues), 19 bits, see alignment 1.3e-07 amino acids 444 to 477 (34 residues), 30.9 bits, see alignment (E = 2.3e-11) amino acids 477 to 512 (36 residues), 25.2 bits, see alignment 1.5e-09 amino acids 547 to 563 (17 residues), 15.7 bits, see alignment (E = 1.3e-06)

Best Hits

KEGG orthology group: None (inferred from 98% identity to bvu:BVU_3794)

Predicted SEED Role

"KWG Leptospira repeat protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (615 amino acids)

>ABI39_RS18775 WG repeat-containing protein (Phocaeicola dorei CL03T12C01)
MILNKKNMRNKKVILILCLLVLVGGSVQAQRLKAVQNEKGRYGFMTEDGTVVIKYKYDEA
TPFKDGIAKIGKDGKYSLINEDGEIITKRKYTYIGEFYNGVCPVAEGGNTKKGVMLTTGG
LIGNKASSNTGEKWGLIDKTGKEILKIDYEAMGDLNKKLIYVLKGKKFGFIDSAGNIIVK
PTYNFIGSFNDQGICWVNIGGKYDKKNNMVSKGKFGLINENGREIIPAKYEDVGNFPILR
DKKTGALLDEAAFYTKADQSAFPATKQEIQSLLLPKPHAAESQLPSSRVDYFYFINKKSQ
GLVDVHGNTIIPLTANQAILPPSDNMLRLAKVEKKQIAKAYYDLDAEVMVRIPSSEKGKF
GAFSHNLAPVSLDDELYFIDKKGNKVIGGLSKAFLSNEGYRVVQKGSAFGAIDSTGAVVI
PIEYTNSLTSVNNGRLGVQKNASWFYVDMKGQIVSDKYDRIGNFHRGYASVCLNKLWGAI
DLQNRVVVPLEWQGVAPIVNPQLIWVKKDNLYYLYDGVQKSVRLKQGFANASNFDNEMAY
VMSDGKWGIIDPDGKILVPCLFEKEEDMVLVKQYMLAEDKKSLTEVEALRVIARFDPDTN
MFKITSVIPDKHWDY