Protein Info for ABI39_RS17820 in Phocaeicola dorei CL03T12C01

Annotation: polyamine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 PF00005: ABC_tran" amino acids 25 to 168 (144 residues), 131.8 bits, see alignment E=2.7e-42 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 40 to 323 (284 residues), 365.9 bits, see alignment E=8.8e-114 PF08402: TOBE_2" amino acids 278 to 346 (69 residues), 32.6 bits, see alignment E=7e-12 amino acids 400 to 456 (57 residues), 23.7 bits, see alignment 4.2e-09

Best Hits

Swiss-Prot: 84% identical to POTA_BACFR: Spermidine/putrescine import ATP-binding protein PotA (potA) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K11072, spermidine/putrescine transport system ATP-binding protein [EC: 3.6.3.31] (inferred from 98% identity to bvu:BVU_3556)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>ABI39_RS17820 polyamine ABC transporter ATP-binding protein (Phocaeicola dorei CL03T12C01)
MSMQQSNYIIEVKGVSKFFGDKMVLDNINLYVKKGEFVTVLGPSGCGKTTLLRLIAGFQT
ASEGEIKIAGKEITQTPPHKRPVNTVFQKYALFPHLNVFDNIAFGLKLKKIPKQTIEKKV
KAALRMVGMTDYEYRDVNSLSGGQQQRVAIARAIVNEPEVLLLDEPLAALDLKMRKDMQM
ELKEMHKTLGITFVYVTHDQEEALTLSDTIVVMSEGKIQQIGTPVDIYNEPINSFVADFI
GESNILNGTMIQDKLVRFAGVEFECVDEGFGENMPVDVVVRPEDWYIFPDSDASQISGIV
TSSIFKGVHYEMVVEANGYEFIVQDYHHFAVGEQVGLLIKPFDIHIMKKERVCNTFEGEL
ADGTHVEFLGCTFECLPVADIEPGAKVKVQVDFKDIILQDNEEDGTLTGDVRFILYKGDH
YHLTVSSDWGEDIFVDTNDVWDNGDHVGISILPESIKVTQVVES