Protein Info for ABI39_RS17125 in Phocaeicola dorei CL03T12C01

Annotation: 30S ribosomal protein S12 methylthiotransferase RimO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 5 to 429 (425 residues), 391 bits, see alignment E=6.5e-121 PF00919: UPF0004" amino acids 6 to 106 (101 residues), 79.1 bits, see alignment E=3.2e-26 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 6 to 428 (423 residues), 466.9 bits, see alignment E=7.4e-144 PF04055: Radical_SAM" amino acids 141 to 312 (172 residues), 85.1 bits, see alignment E=9.9e-28 PF18693: TRAM_2" amino acids 369 to 431 (63 residues), 76.6 bits, see alignment E=2e-25

Best Hits

Swiss-Prot: 99% identical to RIMO_BACV8: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 99% identity to bvu:BVU_3282)

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>ABI39_RS17125 30S ribosomal protein S12 methylthiotransferase RimO (Phocaeicola dorei CL03T12C01)
MKRNTIDIITLGCSKNLVDSEKLMRQLEANGYKVTHDSDKPQGEIAVINTCGFIGDAKEE
SINMILEFCQAKEEGKLKKLYVMGCLSERYLKELALEIPQVDKFYGKFNWNELLADLGKA
YKAEFAIERTLTTPHHYAYLKISEGCDRKCSYCAIPIITGRHISRPMEEIIDEVKLLVSE
GVKEFQIIAQELTYYGVDLYKSQKLPELIERIANVPGVEWIRLHYAYPAHFPEELFRVMR
EHDNVCKYMDIALQHISDNMLNKMRRHVSKAETYELIEKFRREVPGIHLRTTLMVGHPGE
AEEDFEELKEFVKKVRFDRMGAFAYSEEEGTFAAKEYEDSISHEVKQQRLDELMALQQEI
AGELSQTKIGKEFKVIIDRKEGDYYIGRTQFDSPEVDPEVLIKADDEYLKIGEFYKVKIT
AADDFDLYASIL