Protein Info for ABI39_RS16955 in Phocaeicola dorei CL03T12C01

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details PF00672: HAMP" amino acids 78 to 122 (45 residues), 33.9 bits, see alignment 4.7e-12 PF00512: HisKA" amino acids 266 to 334 (69 residues), 62.6 bits, see alignment E=4.5e-21 PF02518: HATPase_c" amino acids 382 to 488 (107 residues), 78 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_3251)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>ABI39_RS16955 HAMP domain-containing protein (Phocaeicola dorei CL03T12C01)
MNIKSKLTLAIGVLVAMIVLLVVLSVVNLQILTATEPDSPAAGPGLQRALLWIYVVGAAC
ICIGIGMWLRLPASIDNPIKELTNAIQEIANHNYKKRLELSNSEEFSEVSKNFNRMAKRL
EDYHASALSDMMASKKYMETIINSINEPIIGLNNDMEILFINDEALNVINLKREEVIKHS
AQDISLRNDLLRRLIRELVEIPGEPVRDKEKEKKEPLKIYADNKESFFQVKYMSISQPGK
DGVTMEKKGYVIMLKNITEFKELDSAKTTFISTISHELKTPISAIMMSLQLLEDQRIGAL
NEEQEDLANSIKENSERLLNITGELLNMTQVESGKLQLKPKITKPIELIEYAIKANRVQA
EKFNIQIEVEYPEDKIGKLFVDSEKIAWVLTNLLSNAIRYSPENGRVVIGARQTDDGFIE
MFVRDFGKGIDPRYHKSIFDHYFRVPGTKVQGSGLGLSISRDFVEAHNGTLTVDSKLGEG
SMFVMRLKA