Protein Info for ABI39_RS16225 in Phocaeicola dorei CL03T12C01

Annotation: YWFCY domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details PF14293: YWFCY" amino acids 5 to 149 (145 residues), 167.1 bits, see alignment E=5.2e-53 PF02534: T4SS-DNA_transf" amino acids 166 to 559 (394 residues), 48.1 bits, see alignment E=1.7e-16 PF10412: TrwB_AAD_bind" amino acids 452 to 553 (102 residues), 31.2 bits, see alignment E=2.3e-11 PF12696: TraG-D_C" amino acids 461 to 572 (112 residues), 55.7 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: None (inferred from 80% identity to bfr:BF0133)

Predicted SEED Role

"Putative mobilization protein BF0133" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (669 amino acids)

>ABI39_RS16225 YWFCY domain-containing protein (Phocaeicola dorei CL03T12C01)
MQQEDDLRGLAKTMDFMRALSILFVVINIYWFCYGQIREWGINIGVVDRILLNFDRTAGL
FRNILWTKLFAVVFLALSCLGTKGVKEEKITWRKITASLATGGVLFFFNWWLLDLPLTAA
ANAAFYILTLSAGYICLLMGGVWMSRLLKNNLMDDPFNNENESFQQETRLIENEYSINLP
TKFYYNKQWNNGFANVVNPQRACICMGSPGSGKSYCVVNQFIKQQIEKGYTQYIYDYKFP
DLSEIAYNHLLNHQKGYKKIPTFYVINFDDPRRSHRCNPIHPDFMTDISDAYESAYTIML
NLNRSWVQKQGDFFVESPIILFAAVIWFLRIYDNGRYCTFPHAIEFLNKRYEDIFPILTS
YPELENYLSPFMDAWLGGAQDQLQGQIASAKIPLSRMISPQLYWVMSGDDFTLDINNPND
PKILCVGNNPDRQNIYGAALGLYNSRIVKLINKKGQLKSGIIIDELPTIYFKGLDNLIAT
ARSNKVAVLLCFQDFSQLKRDYGDKEAAVVMNTVGNIFSGQVVGETAKTLSERFGKVLQK
RQSMTLSRSDKSTSISTQLDSLIPASKISTLTQGMFVGAVADNFDERIEQKIFHCEIVVD
NEKVKAETARYKKIPQITDFTDENGTDHMKQVVQENYERIKAEAGRIVAEELERIKNDPV
LCKLLPEQN