Protein Info for ABI39_RS14970 in Phocaeicola dorei CL03T12C01

Annotation: F0F1 ATP synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 TIGR01039: ATP synthase F1, beta subunit" amino acids 5 to 503 (499 residues), 775 bits, see alignment E=1.3e-237 PF02874: ATP-synt_ab_N" amino acids 8 to 82 (75 residues), 60.3 bits, see alignment E=2.2e-20 PF00006: ATP-synt_ab" amino acids 139 to 385 (247 residues), 206.8 bits, see alignment E=3.3e-65

Best Hits

Swiss-Prot: 100% identical to ATPB_BACV8: ATP synthase subunit beta (atpD) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 100% identity to bvu:BVU_2993)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>ABI39_RS14970 F0F1 ATP synthase subunit beta (Phocaeicola dorei CL03T12C01)
MSQIIGHISQVIGPVVDVYFEGKGIDTDLLLPSIHDALTIKRNDGRILVVEVQQHIGEDT
VRTVAMDSTDGLQRGMEVIPTGHPITMPVGNQIKGRLMNVVGEAVDGMRPLSKEGAFPIH
REPPKFDELSTVQEVLFTGIKVIDLLEPYSKGGKIGLFGGAGVGKTVLIMELINNIAKKH
NGFSVFAGVGERTREGNDLLREMIESGVIRYGEEFKKSMEEGHWDLSKVDYNEVEKSQAT
LVYGQMNEPPGARSSIALSGLTVAESFRDRKNGDSNGPRDILFFIDNIFRFTQAGSEVSA
LLGRMPSAVGYQPTLATEMGQMQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLD
ATTVLSRKITELGIYPAVDPLESTSRILDPLIVGQEHYDVAQRVKQILQRNKELQDIISI
LGMDELSDEDRQTVNRARRVQRFLSQPFAVAEQFTGVPGVMVSIEDTIKGFKMILDGEVD
YLPEQAFLNVGTIEEAIEKGKKLLDAASHKK