Protein Info for ABI39_RS14910 in Phocaeicola dorei CL03T12C01

Annotation: hydroxylamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF03063: Prismane" amino acids 5 to 545 (541 residues), 617.4 bits, see alignment E=1.1e-189 TIGR01703: hydroxylamine reductase" amino acids 5 to 547 (543 residues), 743.8 bits, see alignment E=4.9e-228

Best Hits

Swiss-Prot: 66% identical to HCP_BACFN: Hydroxylamine reductase (hcp) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K00378, hydroxylamine reductase [EC: 1.7.-.-] (inferred from 97% identity to bvu:BVU_2981)

Predicted SEED Role

"Hydroxylamine reductase (EC 1.7.-.-)" in subsystem Nitrosative stress (EC 1.7.-.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>ABI39_RS14910 hydroxylamine reductase (Phocaeicola dorei CL03T12C01)
MENNMFCFQCQETAKGFGCTLKGVCGKNATTARTMDLLLFVVRGISVVADQLRQHSLPVK
KDVDNFIVDALFCTITNANFDDESIMKRIDKGLVIRNDLKHQAFAKDIPLPEADELNWKG
SHDEYDAKAATVGVLREKNEDLRSLKELIMYGLKGMAAYLEHAMRLGHNDESIHRFMQNT
IAQITTKSLSADELTVLALRTGEIGVRTMALLDKANTSSYGNPEITRVNIGTGTRPGILI
SGHDLHDLEELLEQTKDSGVDVYTHGEMLPAHYYPAFKKYTHFVGNYGNAWWKQREEFTS
FNGPILFTTNCIVPPLPNATYKERMFTTNSTGYPGCKHITADEKGHKDYTEIIETAKQCA
APTEIEHGEIMGGFAHNQVFQLADKVVEAVKSGAIRKFIVMAGCDGRMRSRDYYTTFAEM
LPKDTVILTAGCAKYRYNKLGLGDINGIPRVLDAGQCNDSYSLAVIALKLKEVFGLHDIN
ELPIVYNIAWYEQKAVIVLLALLSLGIKEIHLGPTLPAFLSPNVTKVLVENFGVSGIGTV
ESDMKKLGLMNE