Protein Info for ABI39_RS14385 in Phocaeicola dorei CL03T12C01

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 374 (338 residues), 178.8 bits, see alignment E=6.9e-57 PF16576: HlyD_D23" amino acids 47 to 289 (243 residues), 75.5 bits, see alignment E=5.6e-25 PF13533: Biotin_lipoyl_2" amino acids 61 to 105 (45 residues), 35.1 bits, see alignment 1.4e-12 PF13437: HlyD_3" amino acids 170 to 286 (117 residues), 56.3 bits, see alignment E=6.9e-19

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 98% identity to bvu:BVU_2801)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>ABI39_RS14385 efflux RND transporter periplasmic adaptor subunit (Phocaeicola dorei CL03T12C01)
MEKKKIILTTAVAVVVVAGGFWMLGGPEGKSTVDFATEAVTKGNVSNFITATGTIEPVTE
VEVGTQVSGIIDKIYVDYNSVVKKGELIAEMDKVTLQSELQSAKATYDGNKAEYDYQKKL
YDRNRKLHEKQLISDTDYEETVYNFQRAQSALEQSKAALAKAERNLSYATITSPIDGVVT
SRDVEEGQTVASGFETPTLFTIAADLTKMQVVADVDEADIAGVEEGARVTFTVDAYPDDV
FEGVVRQIRLGSTNSTSSSSSTTTSTTVVTYEVVITADNPDLKLKPRLTANATIYTLTKD
NVLTVPNKALRFTPNKDIVGGRKINDCQSSHKVWTLDNNTFTAHPVKIGITDGSKTEIVS
GITENTPVVTETVVKGAMPGMEEPSAGEGERSPFMPGPPGSNKKKNK