Protein Info for ABI39_RS13185 in Phocaeicola dorei CL03T12C01

Annotation: manganese efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details PF02659: Mntp" amino acids 31 to 183 (153 residues), 165.6 bits, see alignment E=3.7e-53

Best Hits

Swiss-Prot: 98% identical to MNTP_BACV8: Putative manganese efflux pump MntP (mntP) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: None (inferred from 98% identity to bvu:BVU_2631)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>ABI39_RS13185 manganese efflux pump (Phocaeicola dorei CL03T12C01)
MTTLEIWLLAISLAMDCFTVSITSGIIMRRICWRTFFIMAFFFGLFQAVMPLIGWFAASR
FSHLIEDYDHWIAFGLLAFLGGRMIKESFSNEDKCCFDPTKLKVVVTLAIATSIDALAIG
ISFAFVGMNSFTSILSPIVIIGFTSFVISTLGSLIGVFCGKRFNLRMELWGGLVLIIIGV
KILIEHLFLS