Protein Info for ABI39_RS13135 in Phocaeicola dorei CL03T12C01

Annotation: DNA replication and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 PF13175: AAA_15" amino acids 1 to 106 (106 residues), 44.5 bits, see alignment E=3.4e-15 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 361 (361 residues), 284.4 bits, see alignment E=7.3e-89 PF02463: SMC_N" amino acids 3 to 363 (361 residues), 67.1 bits, see alignment E=3.2e-22 PF13476: AAA_23" amino acids 5 to 132 (128 residues), 35.5 bits, see alignment E=3.2e-12

Best Hits

Swiss-Prot: 94% identical to RECF_BACV8: DNA replication and repair protein RecF (recF) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 94% identity to bvu:BVU_2620)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>ABI39_RS13135 DNA replication and repair protein RecF (Phocaeicola dorei CL03T12C01)
MILKRISILNYKNLEQAELEFSPKMNCFIGQNGMGKTNLLDAVYYLSFCKSATNPIDSQN
IRHEGDFFVIQGFYETNQGDPEEVYCGLKRRQKKQFKRNKKEYSRLSDHIGFIPLVMVSP
ADAELIAGGSDERRRFMDVVISQYDKEYLDALIRYNKALTQRNALLKSEQEPDEELMLVW
EEMMAFAGEVVFRKRSEFIAEFIPTFQSFYSYISQDKEKVNLAYESHAMNGNLLDIIKES
RKRDRIMGYSLRGIHKDDLVMQLGDFPIKREGSQGQNKTYLIALKLAQFDFLKKTGSNST
PLLLLDDIFDKLDASRVEQIVKLVAGDSFGQIFITDTNRDHLDKILKKIEREYRVFSVED
GCVTERKEVAE