Protein Info for ABI39_RS11795 in Phocaeicola dorei CL03T12C01

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details PF02518: HATPase_c" amino acids 332 to 431 (100 residues), 50.4 bits, see alignment E=2.9e-17

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_2355)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>ABI39_RS11795 PAS domain-containing protein (Phocaeicola dorei CL03T12C01)
MKLKFLFFFLALLLTAVWTILLVLTLKERGALFYIGEGVITFSLVFLVYFYRKVVKPLDI
IGNGMELLREQDFSSRLTPVGQKEADRIVLVFNRMMEQLKDERLRLREQNHFLDLLVSAS
PMGVVILTLDGHISMLNAAALRFLDYSSAEEVRGRLLCELASPLAEEIERIPKDTTETIR
LSDSMIYRCSRLSFVDRGFSHPFILVESLTSEVVKAEKKAYEKVIRMIAHEVNNTTAGIT
STLDTVDGALECMEDTEDLREVMKVCIERCYSMSRFITNFANVVKIPEPQLQSVDVNDRV
AACKTFMETVCRNRKITLHLDLCKENPEVMMDTSLFEQVLVNIIKNAAESIGETGDIFIR
TSVSPTMLEIADTGAGISKEVETKLFSPFFSTKPNGQGIGLIFIREVLIKHGCTFSLRTY
PDKLTRFRIRF