Protein Info for ABI39_RS11775 in Phocaeicola dorei CL03T12C01

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 334 to 357 (24 residues), see Phobius details amino acids 380 to 406 (27 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 242 (222 residues), 59.5 bits, see alignment E=5.8e-20 PF02687: FtsX" amino acids 285 to 411 (127 residues), 56.4 bits, see alignment E=3.1e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_2351)

Predicted SEED Role

"Macrolide-specific ABC-type efflux carrier (TC 3.A.1.122.1)" (TC 3.A.1.122.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>ABI39_RS11775 ABC transporter permease (Phocaeicola dorei CL03T12C01)
MKQLLLQAFNLIRQNPFYATISIIGTAVTIAFVMVVVMIYDFRTMDMAPESDRSDMMYTG
SGMTYRKQDHTNQNSGMGRKAFEALFSELPGVKEVTWYRGVSKTPCNLSASNEIFNYFVR
PVADNWFKFFDYEFIAGRPFTQEEYDARRCVSVVTERMALQLFGTTDVVGKEYQSNFFPT
KVVGVVKDVNAIFQTAYADAFVPFSLENEDYYATWTGGLGGIRLGLLKLLPDTRPAEVRT
EVQHRQDRLNSSTAEYAFEMNELYTHTEYTFFRGKDISAPLVYSMLLMVLLIVPAINISG
MTNARMQERVTEIAVRKAYGASRISIMVRLFLENLFTVFLGGILGYLFSCVLVWLGRVWL
FGSGEVELSDISLDGGLLLHPALFVLVFGVCVVFNLLSVLIPVWMVTHRNIATTIKGE