Protein Info for ABI39_RS11415 in Phocaeicola dorei CL03T12C01

Annotation: DUF418 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 87 (27 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details PF04235: DUF418" amino acids 234 to 394 (161 residues), 148.8 bits, see alignment E=7.3e-48

Best Hits

KEGG orthology group: K07148, uncharacterized protein (inferred from 99% identity to bvu:BVU_2269)

Predicted SEED Role

"conserved hypothetical protein, putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>ABI39_RS11415 DUF418 domain-containing protein (Phocaeicola dorei CL03T12C01)
METKAINTKLKGHARVDVADVLRGLAVMGIIILHSIEHFNFYSFPDTAGQSAWLNFSDKA
IWNGLFFMFGGKAYAIFALLFGFSFFIQDDNQRLRGNDFRLRFCWRLILLFLIGNINASF
FTAEVLVLYSLVGFILPLTCRLKDKWIFALACLLLIQPLPLYYVIRACLDPEFVTPAIPT
RSFWNATFAVQSNGNFLETIRVNLWEGQLASLAWAWDHGRVFQTAALFLLGMLIGRKGLF
LKEHLKVWNKVLAGSLISFFPLYGLGNMLPDFITNKSILTPLSLIITSLSNFAFMLILVS
GVVFAFYKTNLHDGLMKITPYGKMSLTNYITQSIVGSMLYYNWGFALHNQFGITASCLAG
IVFFILQFSFCRWWMNHHSHGPMEYIWKRATWLK