Protein Info for ABI39_RS11410 in Phocaeicola dorei CL03T12C01

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 transmembrane" amino acids 185 to 194 (10 residues), see Phobius details PF13181: TPR_8" amino acids 524 to 557 (34 residues), 17.6 bits, see alignment (E = 1.8e-06) amino acids 564 to 591 (28 residues), 20.4 bits, see alignment (E = 2.3e-07) amino acids 597 to 624 (28 residues), 12.2 bits, see alignment (E = 9.7e-05) amino acids 663 to 690 (28 residues), 21.5 bits, see alignment (E = 1e-07) PF12895: ANAPC3" amino acids 560 to 617 (58 residues), 36.6 bits, see alignment 2.4e-12 PF07719: TPR_2" amino acids 563 to 591 (29 residues), 24.4 bits, see alignment (E = 1.2e-08) PF13176: TPR_7" amino acids 563 to 581 (19 residues), 14.8 bits, see alignment (E = 1.4e-05) PF13174: TPR_6" amino acids 564 to 590 (27 residues), 16.1 bits, see alignment (E = 7.9e-06) PF00515: TPR_1" amino acids 564 to 591 (28 residues), 29 bits, see alignment (E = 3.6e-10) PF13432: TPR_16" amino acids 568 to 627 (60 residues), 24.5 bits, see alignment 1.8e-08 PF14559: TPR_19" amino acids 570 to 620 (51 residues), 35.1 bits, see alignment 7.5e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to bvu:BVU_2268)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (725 amino acids)

>ABI39_RS11410 tetratricopeptide repeat protein (Phocaeicola dorei CL03T12C01)
MREEIIKLLDQYRLKEALSQMTGYATHTSDWQLKNELEALQTSYDLMLQYTSKGMKDPNK
VEIYHKMLRTAYELTDRIHIAVQATQNYGVYYDTMRTFVQSPPHSYAELQMQLEAYTEDM
ATAPLIYTTEAKRNEEMDAMRKRHETAVDELFEKIWVSTRWSESEYAEAQILFNSLLIQV
NDLSIMVSAVTMSLLQIFDIRKFMFLLNAYTHQDTMLNQRAIAGIALTCYYYEKRILQYP
EAVSRINELNENTEFIKNLHHIQIQLLQSSRETRKIDKKMREEIIPEMMKNPKLNLEGLD
EDAEDHNPEWEEWIDRSGITDKLRELGELQMSGADVYMSTFSQLKQFPFFRKISHWFYPF
DPQYQDIAKLSLGNDEQKISLLNILMNSDVFCNSDKYSFCFTMLQMPESQRNLMQQQLNG
QHEASEELKERLKEMSQSKARAEFVSRQYIHDLYRFFKLWSRRHEIHDIFEDTLDLWNKE
TLSQALLHKDYINKLADYLFTHDDLTEAGILYDKSIELYNRKNAELWQKAGFIYQKIGSY
KKAIDYYLQSDLLIPDNAWNNRHLAQCYRKEGNYQQALEYYNKVEQVQPDNLNLTLQIGQ
CLMALERYDEALAYFFKVEYLDKKPQNARRAIGWCSFITGNHQQAKKYYDLLISEPKPIM
EDWMNAGHVYYILNETEKSIEYYRKAQELCGSHDEFVRLYQIDKKDLIKQGANEVDLFIL
PDELI