Protein Info for ABI39_RS11315 in Phocaeicola dorei CL03T12C01

Annotation: urea transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 160 to 184 (25 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details PF03253: UT" amino acids 12 to 282 (271 residues), 243.8 bits, see alignment E=1.1e-76

Best Hits

KEGG orthology group: K08717, urea transporter (inferred from 56% identity to bfs:BF1925)

Predicted SEED Role

"Eukaryotic-type low-affinity urea transporter" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>ABI39_RS11315 urea transporter (Phocaeicola dorei CL03T12C01)
MKTISIYDSLLVLGRGIGQVMFQNNALSGLLMLVGIFLNSWQLGVLAVGGNIISTLAACI
SGYGRDDIKNGLYGFNGTLIGIAVGVFMQLSLWSLLLMAVASCFSTWIVRLFSRQHSLPG
FTAPFIFSVWILLGICTWITPDLLLVSETVSDTVREVDYVQAFCLGIGQVMFQENLLTGL
FFLAGIGVNSWTGTFYTALGTLLPVLFAVFWGIDPEMLNMGLMGYNGVLCALALGGKTWK
SFVWALCSVLLSVVLQFAGIKLGITTLTAPFVLSVWMIMIMQKVVNTKGE