Protein Info for ABI39_RS11295 in Phocaeicola dorei CL03T12C01

Annotation: queuosine precursor transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 17 to 206 (190 residues), 124.9 bits, see alignment E=1.8e-40 PF02592: Vut_1" amino acids 41 to 200 (160 residues), 174.7 bits, see alignment E=8.7e-56

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 99% identity to bvu:BVU_2245)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>ABI39_RS11295 queuosine precursor transporter (Phocaeicola dorei CL03T12C01)
MKNNNTVSVSFMLLGILFCVCLVAANLLETKVVQIWKITATAGLVVFPISYIINDCIAEV
WGFRKARLIIWMGFAMNFMVVALGQLAILMPAAPFWEGEEGFNFVFGMAPRIAVASLTAF
LVGSFLNAYVMSKMKLASGGKNFSLRAITSTLVGESADSMIFFPVAFGGLMPAGELIKMM
VIQAVLKTLYEIIILPVTIRVVNYIKKVDGSDVFDEHISYNVLKIKEL