Protein Info for ABI39_RS11080 in Phocaeicola dorei CL03T12C01

Annotation: EpsG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 82 to 133 (52 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details PF14897: EpsG" amino acids 42 to 369 (328 residues), 98 bits, see alignment E=3.1e-32

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>ABI39_RS11080 EpsG family protein (Phocaeicola dorei CL03T12C01)
MSTIRLIYILLHVLEIWMLFVAGRKMSQTKTDKEYWKASLWAFVPYVFVLGLRFGHNIDW
NLYCVRYLEHKSMDWNTTEPIYHFLFYLFNSIGVPYFIVISFQVALFMFSFLLVAKHFKN
CLYYVLPLLPVVAQSNDNYIRWYLAVSFALISLYFLLSDNKKKYIKCILAFIVGVLIHNG
TLLLLAFIPVYYFGRKKHIPIIISVITVFLSVFVVSISIMSFLSEIALSVYYLGGNSLQD
VRLSTYLLKVSGMVTEGYGITGIGEYNLRNKVFTFVSFLPVIIYGPRYLNSYKWGILTYN
LFIIGAFLNPFFSTIEIFDRYSKALLIFQAIVAGIVYYKLLKSKDTISAVRIFSLVSLLC
CFYPFIRYSCMTTADYRMMYIWDSNGRDYINTDLYINDFINN