Protein Info for ABI39_RS10805 in Phocaeicola dorei CL03T12C01

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 71 to 96 (26 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 196 to 221 (26 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 332 to 357 (26 residues), see Phobius details PF00375: SDF" amino acids 9 to 380 (372 residues), 268.3 bits, see alignment E=6e-84

Best Hits

KEGG orthology group: None (inferred from 97% identity to bvu:BVU_2202)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>ABI39_RS10805 dicarboxylate/amino acid:cation symporter (Phocaeicola dorei CL03T12C01)
MKKFLSNTIVQLLIAVIIGLSAGFVVNDAVLEAIVCIKHITGQIIFFLVPLIILGFIAPS
IAHLRSNASKMLLFAFGIAYLSSIGASFFGAAVGYNVIPFLHIADDANSLKALPENLLKI
DIPPVMNVMTALVLAALIGLATAWVKSDEISKLLDTFQKMVLELVKRVLLPVLPVFIAAN
FCILSYQGAVTKQLPVFLSILIVVIVCHFIWLTLLYFIAAVYSRKNSYQVLRYYGPAYLT
ALGTMSSAATLGIALECARKSPILRKEISDVTIPLFANIHLCGSILTETVFVLTVSQMLY
GSMPSILQITLFILLLGLFAIGAPGVPGGTVLASLGLIISVLHFDEAGTALLLTIFALQD
SFGTACNITGDGALTLITDTFEKK