Protein Info for ABI39_RS10540 in Phocaeicola dorei CL03T12C01

Annotation: beta-N-acetylglucosaminidase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02838: Glyco_hydro_20b" amino acids 22 to 143 (122 residues), 82.4 bits, see alignment E=1.2e-26 PF07555: NAGidase" amino acids 149 to 441 (293 residues), 426.9 bits, see alignment E=1e-131 PF21809: Glyco_hydro_84_hel" amino acids 458 to 591 (134 residues), 184.9 bits, see alignment E=1.5e-58 PF21774: NagJ_C" amino acids 462 to 560 (99 residues), 38.3 bits, see alignment E=5.1e-13 PF18344: CBM32" amino acids 606 to 669 (64 residues), 97.1 bits, see alignment E=1.1e-31

Best Hits

Swiss-Prot: 70% identical to OGA_BACTN: O-GlcNAcase BT_4395 (BT_4395) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01197, hyaluronoglucosaminidase [EC: 3.2.1.35] (inferred from 98% identity to bvu:BVU_2069)

Predicted SEED Role

"Hyaluronidase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (737 amino acids)

>ABI39_RS10540 beta-N-acetylglucosaminidase domain-containing protein (Phocaeicola dorei CL03T12C01)
MKKMHLAIICLFTGCTIFAQNIDVQPIPQQVSKQGGQINLPETYQLLGETEANPYAVQEL
KDLLGGKHPANTGLRIYIGEKGDKSIRKFTRQIPNQKEGYYLSINNKEIILAGNDERGTY
YALQTLKQLLKDNQLPIIEIQDYPAICYRGVVEGFYGTPWSHNARLRQLQFYGENKMNTY
IYGPKDDPYHSSPNWRLPYPEKEAKQLQELVKVAQENEIDFVWAIHPGQDIKWNKEDREL
LLAKFEKMYHLGVRSFAVFFDDISGEGTNPVKQVELLNYIDEHFVKVKPDVTPLIMCPTE
YNKSWSDPAKGYLTTLGDKLNPSIQIMWTGDRVISDITQDGIQWINDRIKRPAYIWWNFP
VSDYVRDHLLMGPVYGNDTQIAHQMSGFVTNPMEHAEASKIAIYSVASYAWNPQKYNSEK
TWKDAIMNILPDAATELEFFAAHNSDLGPNGHKYRREESVNLQPTAQSFTESYIKNKTYT
EKDFSILQETFSQMIESSDILVAHADKNPIIVEIMPWLYQFKLLGETGNEVLAMVKAYDK
NDQSLFMRKYKHVKALQQQMFQIDQTYNQNPYQPGIKTAGRVIKPLIDQTFATVTQCYNQ
KYSTLLNAETDYMPHKLISDISQIKNLPLQVKINRIQISPALEVIKWPGNGSLTIELDQV
YPGENIEIDFGKPEIATWGSLEISANGKDWSKVNFTQEKNLLTASLQQKPIKAVRFTNMQ
HQEQEIYLRRFIITIDK