Protein Info for ABI39_RS10295 in Phocaeicola dorei CL03T12C01

Annotation: polysaccharide deacetylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00657: Lipase_GDSL" amino acids 28 to 242 (215 residues), 42.5 bits, see alignment E=1.8e-14 PF13472: Lipase_GDSL_2" amino acids 31 to 197 (167 residues), 51.5 bits, see alignment E=3.6e-17 PF01095: Pectinesterase" amino acids 265 to 318 (54 residues), 31.6 bits, see alignment 1.5e-11 PF01522: Polysacc_deac_1" amino acids 347 to 466 (120 residues), 89.3 bits, see alignment E=3.8e-29

Best Hits

Predicted SEED Role

"rhamnogalacturonan acetylesterase" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>ABI39_RS10295 polysaccharide deacetylase family protein (Phocaeicola dorei CL03T12C01)
MKLKVLLALCALLLLSAFIAERKEPITIFMIGDSTMANKSLKNGNIERGWGQMFPGYFTE
EVVVDNHAMNGRSSLSFINEGRWDVVLSKIHKGDYVFIQFGHNDEKPRATLHTEPGSTFD
DNLRRFVNETRAKGGNPVLFNSIVRRNFPPKGVTEIKGSYEKEGPVLVDTHGEYLESPRR
VAGEMNVPFIDLNKLTHDLVTGMGVENSRKLFMWIPAGQYEFCPEGKIDNTHLNIYGGRI
VAGLVVDALMEEVPALAKYVRRYDYVVAKDGSGDFFTVQEAVNAAVGGGKKTISILVRPG
VYEEYVSMPESSPRIELVKQTGAEIRDNGFTQDVYVAPYKGDRVCAISYTFDDGLQEHYT
LLFPKLEKYGFKGTFWIWGKCIENESAMQGKPRMSWAQIKEMSDKGQEISSHSWSHTNLK
RVSLEEVKMEVEKNDSILYEKTGKIPRTFCYPFNAVNSDILKITSKNRVGTRTEQYPIGG
DKSKSTPESLDKWVESLVNSGRWGVAMIHGISQGYDAFLNPEILWEHFSKVKALENKIWV
GTFREVAAYTKEREKIRLNVLEKENGYNITPHLDMNAQLFTEPLTMVLKSVGNRVSEIRQ
DGKKLFLKKDADKILFDFNPYGGMIQIRFI