Protein Info for ABI39_RS10120 in Phocaeicola dorei CL03T12C01

Annotation: FprA family A-type flavoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF00753: Lactamase_B" amino acids 30 to 164 (135 residues), 38.4 bits, see alignment E=2.7e-13 PF19583: ODP" amino acids 30 to 222 (193 residues), 72.8 bits, see alignment E=7.1e-24 PF12724: Flavodoxin_5" amino acids 249 to 357 (109 residues), 32.2 bits, see alignment E=2.4e-11 PF00258: Flavodoxin_1" amino acids 250 to 371 (122 residues), 47.1 bits, see alignment E=5.8e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_1993)

Predicted SEED Role

"Alkyldihydroxyacetonephosphate synthase (EC 2.5.1.26)" (EC 2.5.1.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>ABI39_RS10120 FprA family A-type flavoprotein (Phocaeicola dorei CL03T12C01)
MEIKGKVHYVGVNDRNKALFENLWPLPYGVSYNSYLIDDEMVALVDTVDVCYFEVYLKKI
RSIIGDKPINYLIINHMEPDHSGSISLIKQYYPNIVIVGNKKTFEMIEGFYGVGGERYVV
GEGDFLALGHHRLRFSLIPMVHWPETMVTFDETEGILFSGDAFGCFGALNGGVVDTNINT
DIYWNEMVRYYSNIVGKYGAPVQKALQKLQNLKITTVCSTHGPVWTEEIPRVVRIYDRLS
RYEAEEGVVIAYGSMYGNTEEVAEVIAEELSKQGIRNIVMHNVSHTSHSFIIADVFKYKG
LIVGCPTYNTQMYPEMEALLSKLASREIKGRYLGYFGSFTWASAAVKKIAEFNDKLKFEP
VGNPVEMKHSMKAETNTQAKELAKAMADRLKADRK