Protein Info for ABI39_RS06630 in Phocaeicola dorei CL03T12C01

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details PF01694: Rhomboid" amino acids 64 to 214 (151 residues), 87.8 bits, see alignment E=7.6e-29 PF20216: DUF6576" amino acids 254 to 297 (44 residues), 46.2 bits, see alignment 4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_0994)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>ABI39_RS06630 rhomboid family intramembrane serine protease (Phocaeicola dorei CL03T12C01)
MGSFITDLKNSFNKGNIYIQFIYINVGVFIVTSLLGILWMLFNRNGAFVLQYLELPAWTL
QFVKQPWSLLTYMFMHAGILHLLFNMLWLYWFGQMFLSLFSAKHFRGLYLLGGICGGLLY
MIAYNVFPYFSDSLYYSYLLGASASVLAIVVATAVRAPEYRVNFMFIGTVRLKYVALFMV
VTDLLFMTSGNAGGHIAHLGGALAGWWFASGLSRGHDATSWINRCLDCFSEGLSFRRQSK
KPKMKVHYGDKAKDYDYNARKKQQSEEIDRILDKLKKSGYNSLTTEEKKSLFDASKK