Protein Info for ABI39_RS06310 in Phocaeicola dorei CL03T12C01

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF07638: Sigma70_ECF" amino acids 9 to 163 (155 residues), 23.5 bits, see alignment E=9.5e-09 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 20 to 175 (156 residues), 153.4 bits, see alignment E=6.2e-49 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 24 to 172 (149 residues), 68.3 bits, see alignment E=6.1e-23 PF04542: Sigma70_r2" amino acids 25 to 87 (63 residues), 30.5 bits, see alignment E=4.9e-11 PF08281: Sigma70_r4_2" amino acids 120 to 169 (50 residues), 53.2 bits, see alignment E=3.8e-18 PF04545: Sigma70_r4" amino acids 124 to 169 (46 residues), 32.7 bits, see alignment E=8.6e-12

Best Hits

KEGG orthology group: None (inferred from 95% identity to bvu:BVU_1053)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>ABI39_RS06310 RNA polymerase sigma-70 factor (Phocaeicola dorei CL03T12C01)
MNLNDNRLIIKTLRSGDQKVFSLVYASYYKPLCLFCSSYVSLEEAEEIVQDLMMYVWEKR
ESLVEDLSLKSFLFTSVRNRALNSITRSHITRQVYEEYQSQQLKSLPALDSCYSTELFNA
YMEALHALPKEQQKVYVMSRYKQLTHKEIADTLEVSVQTVNYRIGKALQFFRIRLKDFCL
K