Protein Info for ABI39_RS05570 in Phocaeicola dorei CL03T12C01

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 316 to 340 (25 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 10 to 366 (357 residues), 165.9 bits, see alignment E=6.5e-53

Best Hits

KEGG orthology group: None (inferred from 98% identity to bvu:BVU_1181)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>ABI39_RS05570 acyltransferase (Phocaeicola dorei CL03T12C01)
MEINKRENIGWIDLLRVTACFLVVFAHCCDPFVARFDTDRPTFLQGCALGSAVRCCVPLF
VMMTGVLLFPVRNGMSEFYKKRIGRIAVPLIFWSVMLPVLYFIYLNYITTTDNPTIDMSA
FTLEKTITKIWTFIFNFNYDTTPLWYLYMLVGLYFIIPIFHAWLERATRKDIKLFLSIWG
ISLFLPYIKMAAPALGYIGNWGNMDILGVCDWNAFGSFYYVSGFIGYLILAHYLVKYPLQ
WSWRKTLAIGIPMFMAGYAITFGGYLIMQEYFPGNYAYLEIVWLFGGINVFMMTFPVFVC
IQKLKIPSSPALSKVASMTFGIYLCHFVFVQMGYDLFASLLPQGTPAIMHIICMAVTAFL
ISYLVVRGMYACKWTRRFVA